PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015882253.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family NAC
Protein Properties Length: 258aa    MW: 29482.2 Da    PI: 8.4807
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015882253.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM151.63.7e-47141381128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrF+Ptdee++ +yL++kv   +l++  +i+e++++k++PwdLp  +    +e yfFs+++ ky++gkr+nr+t+sgyWkatg+dk+ +s+
  XP_015882253.1  14 LPPGFRFQPTDEEIIFQYLRRKVFCCPLPA-CIIPEINVCKYDPWDLPGDL---GQERYFFSNKEAKYRNGKRTNRTTNSGYWKATGSDKRFVSS 104
                     79*************************999.78***************543...5799******************************9998887 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128
                       ++ vglkktLvf++g+ p+g++t+Wvmhey+l
  XP_015882253.1 105 rMNHIVGLKKTLVFHRGKPPHGSRTEWVMHEYSL 138
                     46778***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.92E-5311173IPR003441NAC domain
PROSITE profilePS5100552.95914173IPR003441NAC domain
PfamPF023653.1E-2515138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MEKFNFLRDG VIRLPPGFRF QPTDEEIIFQ YLRRKVFCCP LPACIIPEIN VCKYDPWDLP  60
GDLGQERYFF SNKEAKYRNG KRTNRTTNSG YWKATGSDKR FVSSRMNHIV GLKKTLVFHR  120
GKPPHGSRTE WVMHEYSLID AAGSKTCTKT MEMHAQNSLN QTENWVLCRI FMRKRNAKDG  180
EEITHENNFK DYNKAGQVGV EQPRLLISNF VMGCKNNGHL GPDQISCSSS SSSSSSITEI  240
SEVSSSEADC HEESSTNF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-441217815170NO APICAL MERISTEM PROTEIN
1ut4_B7e-441217815170NO APICAL MERISTEM PROTEIN
1ut7_A7e-441217815170NO APICAL MERISTEM PROTEIN
1ut7_B7e-441217815170NO APICAL MERISTEM PROTEIN
4dul_A7e-441217815170NAC domain-containing protein 19
4dul_B7e-441217815170NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015866948.10.0PREDICTED: NAC domain-containing protein 83-like
RefseqXP_015882253.10.0PREDICTED: NAC domain-containing protein 83-like
SwissprotQ9FY935e-78NAC83_ARATH; NAC domain-containing protein 83
TrEMBLA0A0M4FP123e-96A0A0M4FP12_MANES; NAC transcription factors 34
STRINGVIT_01s0146g00280.t012e-91(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF70434139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.12e-78NAC domain containing protein 83